| Edit |   |
|---|
| Antigenic Specificity | CXCL1/GRO alpha/KC/CINC-1 |
|---|
| Clone | 7A11 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CXCL1/GRO alpha/KC/CINC-1 Antibody (7A11) from Novus Biologicals is a mouse monoclonal antibody to CXCL1/GRO alpha/KC/CINC-1. This antibody reacts with human. The CXCL1/GRO alpha/KC/CINC-1 Antibody (7A11) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | CXCL1 (AAH11976, 36 a.a. - 107 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN |
|---|
| Other Names | n/a |
|---|
| Gene, Accession # | CXCL1, Gene ID: 2919, Accession: AAH11976, SwissProt: AAH11976 |
|---|
| Catalog # | H00002919-M01 |
|---|
| Price | |
|---|
| Order / More Info | CXCL1/GRO alpha/KC/CINC-1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|