| Edit |   |
|---|
| Antigenic Specificity | CXCL6/GCP-2 |
|---|
| Clone | 2G3 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA. It has been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CXCL6/GCP-2 Antibody (2G3) from Novus Biologicals is a mouse monoclonal antibody to CXCL6/GCP-2. This antibody reacts with human. The CXCL6/GCP-2 Antibody (2G3) has been validated for the following applications: ELISA. |
|---|
| Immunogen | CXCL6 (AAH13744, 38 a.a. - 114 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN |
|---|
| Other Names | chemokine (C-X-C motif) ligand 6 (granulocyte chemotactic protein 2), Chemokine alpha 3, CKA-3Granulocyte chemotactic protein 2, GCP2member 6 (granulocytechemotactic protein 2), GCP-2Small-inducible cytokine B6, Small inducible cytokine subfamily B (Cys-X-Cys), member b |
|---|
| Gene, Accession # | CXCL6, Gene ID: 6372, Accession: AAH13744, SwissProt: AAH13744 |
|---|
| Catalog # | H00006372-M07 |
|---|
| Price | |
|---|
| Order / More Info | CXCL6/GCP-2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|