| 产品详情 |
| Edit |   |
| Antigenic Specificity | Ferroportin/SLC40A1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Ferroportin/SLC40A1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Ferroportin/SLC40A1. This antibody reacts with human. The Ferroportin/SLC40A1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Ferroportin/SLC40A1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VKAGLKEEETELKQLNLHKDTEPKPLEGTHLMGVKDSNIHELEHEQEPTCASQMAEPFRTFRDGWVSYYN |
| Other Names | Ferroportin-1, FPN1, FPN1IREG1ferroportin 1, HFE4ferroportin-1, Iron-regulated transporter 1, member 3, MST079, MTP1, putative ferroportin 1 variant IIIB, SLC11A3iron regulated gene 1, solute carrier family 11 (proton-coupled divalent metal ion transporters), solute carrier family 40 (iron-regulated transporter), member 1, solute carrier family 40 member 1 |
| Gene, Accession # | SLC40A1, Gene ID: 30061 |
| Catalog # | NBP2-49454 |
| Price | |
| Order / More Info | Ferroportin/SLC40A1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|