| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Coagulation Factor II/Thrombin |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Coagulation Factor II/Thrombin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Coagulation Factor II/Thrombin. This antibody reacts with rat. The Coagulation Factor II/Thrombin Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to the N terminal of F2. Immunizing peptide sequence CQLWRSRYPHRPDINSTTHPGADLKENFCRNPDSSTSGPWCYTTDPTVRR. |
|---|
| Other Names | Coagulation Factor II, coagulation factor II (thrombin) receptor-like 2, Coagulation factor II receptor-like 2, Coagulation factor II receptor-like 2 (protease-actovated receptor 3), PAR-3, PAR3proteinase-activated receptor 3, protease-activated receptor 3, proteinase-activated receptor-3, PT, serine protease, Thrombin receptor-like 2 |
|---|
| Gene, Accession # | F2, Gene ID: 2147, Accession: P18292 |
|---|
| Catalog # | NBP1-74142-20ul |
|---|
| Price | |
|---|
| Order / More Info | Coagulation Factor II/Thrombin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|