| Edit |   |
|---|
| Antigenic Specificity | CNTNAP4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CNTNAP4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CNTNAP4. This antibody reacts with human. The CNTNAP4 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to CNTNAP4(contactin associated protein-like 4) The peptide sequence was selected from the N terminal of CNTNAP4. Peptide sequence KLPSTSTLVNLTLGSLLDDQHWHSVLIQRLGKQVNFTVDEHRHHFHARGE. |
|---|
| Other Names | CASPR4KIAA1763cell recognition protein CASPR4, Cell recognition molecule Caspr4, contactin associated protein-like 4, contactin-associated protein-like 4 |
|---|
| Gene, Accession # | CNTNAP4, Gene ID: 85445, Accession: Q9C0A0, SwissProt: Q9C0A0 |
|---|
| Catalog # | NBP1-59223 |
|---|
| Price | |
|---|
| Order / More Info | CNTNAP4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|