| Edit |   |
|---|
| Antigenic Specificity | TRIM45 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TRIM45 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TRIM45. This antibody reacts with human. The TRIM45 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to TRIM45(tripartite motif-containing 45) The peptide sequence was selected from the N terminal of TRIM45. Peptide sequence FKAPRLLPCLHTVCTTCLEQLEPFSVVDIRGGDSDTSSEGSIFQELKPRS. |
|---|
| Other Names | RING finger protein 99, RNF99FLJ13181, tripartite motif containing 45, tripartite motif-containing 45, tripartite motif-containing protein 45 |
|---|
| Gene, Accession # | TRIM45, Gene ID: 80263, Accession: Q9H8W5, SwissProt: Q9H8W5 |
|---|
| Catalog # | NBP1-53109 |
|---|
| Price | |
|---|
| Order / More Info | TRIM45 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 28542145 |
|---|