| Edit |   |
| Antigenic Specificity | TRIM43 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TRIM43 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TRIM43. This antibody reacts with human. The TRIM43 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to TRIM43(tripartite motif-containing 43) The peptide sequence was selected from the C terminal of TRIM43. Peptide sequence NSTMVNSEDIFLLLCLKVDNHFNLLTTSPVFPHYIEKPLGRVGVFLDFES. |
| Other Names | tripartite motif containing 43, tripartite motif-containing 43, tripartite motif-containing protein 43 |
| Gene, Accession # | TRIM43, Gene ID: 129868, Accession: Q96BQ3, SwissProt: Q96BQ3 |
| Catalog # | NBP1-55071 |
| Price | |
| Order / More Info | TRIM43 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |