| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PLA2G12B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PLA2G12B Antibody from Novus Biologicals is a rabbit polyclonal antibody to PLA2G12B. This antibody reacts with human. The PLA2G12B Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PLA2G12B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DTEESYSDWGLRHLRGSFESVNSYFDSFLELLGGKNGVCQYRCRYGKAPMPRPGYKPQEPNGCGSYFLGLKVPESM |
|---|
| Other Names | group XIIB secretory phospholipase A2-like protein, group XIII secreted phospholipase A2, Group XIII secretory phospholipase A2-like protein, GXIIBMGC138151, GXIII sPLA2-like, GXIIIsPLA2, phospholipase A2, group XIIB, phospholipase A2, group XIII, PLA2G13, sPLA2-GXIIB |
|---|
| Gene, Accession # | PLA2G12B, Gene ID: 84647, Accession: Q9BX93, SwissProt: Q9BX93 |
|---|
| Catalog # | NBP2-31685 |
|---|
| Price | |
|---|
| Order / More Info | PLA2G12B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|