| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PLA2G4A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PLA2G4A Antibody from Novus Biologicals is a rabbit polyclonal antibody to PLA2G4A. This antibody reacts with human. The PLA2G4A Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PLA2G4A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TVVKKYEENPLHFLMGVWGSAFSILFNRVLGVSGSQSRGSTMEEELENITTKHIVSNDSSDSDDESHEPKGTENEDAGSDYQ |
|---|
| Other Names | calcium-dependent phospholipid-binding protein, cPLA2, cPLA2-alpha, lysophospholipase, MGC126350, phosphatidylcholine 2-acylhydrolase, Phospholipase A2 group IVA, phospholipase A2, group IVA (cytosolic, calcium-dependent), PLA2G4cytosolic phospholipase A2 |
|---|
| Gene, Accession # | PLA2G4A, Gene ID: 5321, Accession: P47712, SwissProt: P47712 |
|---|
| Catalog # | NBP2-38616 |
|---|
| Price | |
|---|
| Order / More Info | PLA2G4A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|