| Edit |   |
|---|
| Antigenic Specificity | C1qTNF1/CTRP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The C1qTNF1/CTRP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C1qTNF1/CTRP1. This antibody reacts with human. The C1qTNF1/CTRP1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to C1QTNF1(C1q and tumor necrosis factor related protein 1) The peptide sequence was selected from the N terminal of C1QTNF1. Peptide sequence YPATAVPQINITILKGEKGDRGDRGLQGKYGKTGSAGARGHTGPKGQKGS. |
|---|
| Other Names | C1q and tumor necrosis factor related protein 1, CTRP1G protein-coupled receptor-interacting protein, FLJ90694, G protein coupled receptor interacting protein, GIPcomplement C1q tumor necrosis factor-related protein 1, ZSIG37 |
|---|
| Gene, Accession # | C1QTNF1, Gene ID: 114897, Accession: Q9BXJ1, SwissProt: Q9BXJ1 |
|---|
| Catalog # | NBP1-62296 |
|---|
| Price | |
|---|
| Order / More Info | C1qTNF1/CTRP1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|