| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TRIF/TICAM1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TRIF/TICAM1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TRIF/TICAM1. This antibody reacts with human. The TRIF/TICAM1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human TRIF/TICAM1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AFDILGAAGQDKLLYLKHKLKTPRPGCQGQDLLHAMVLLKLGQETEARISLEALKADAVARLVARQWAGVDSTEDPEEPPDVSWAVARLYHL |
|---|
| Other Names | MGC35334, Proline-rich, vinculin and TIR domain-containing protein B, PRVTIRBTIR domain-containing adapter protein inducing IFN-beta, Putative NF-kappa-B-activating protein 502H, TICAM-1TIR domain containing adaptor inducing interferon-beta, TIR domain-containing adapter molecule 1, TIR domain-containing adaptor molecule 1, toll-like receptor adaptor molecule 1, TRIFToll-interleukin-1 receptor domain-containing adapter protein inducinginterferon beta |
|---|
| Gene, Accession # | TICAM1, Gene ID: 148022 |
|---|
| Catalog # | NBP1-89566 |
|---|
| Price | |
|---|
| Order / More Info | TRIF/TICAM1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|