| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SR-BI |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SR-BI Antibody from Novus Biologicals is a rabbit polyclonal antibody to SR-BI. This antibody reacts with human. The SR-BI Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: CYLFWSSSKKGSKDKEAIQAYSESLMTSAPKGSVLQEAKL |
|---|
| Other Names | CD36 and LIMPII analogous 1, CD36 antigen, CD36 antigen (collagen type I receptor, thrombospondin receptor)-like 1, CD36L1scavenger receptor class B type 1, CLA1 CD36 antigen-like 1, CLA-1 HDLQTL6, Collagen type I receptor, thrombospondin receptor-like 1, MGC138242, SCARB1, scavenger receptor class B type III, scavenger receptor class B, member 1, SR-B1, SRB1 scavenger receptor class B member 1, SRBI |
|---|
| Gene, Accession # | SCARB1, Gene ID: 949 |
|---|
| Catalog # | NBP2-62676 |
|---|
| Price | |
|---|
| Order / More Info | SR-BI Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|