| Edit |   |
|---|
| Antigenic Specificity | SRBD1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SRBD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SRBD1. This antibody reacts with human. The SRBD1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry. |
|---|
| Immunogen | Synthetic peptides corresponding to SRBD1(S1 RNA binding domain 1) The peptide sequence was selected from the N terminal of SRBD1. Peptide sequence MSSLPRRAKVQVQDVVLKDEFSSFSELSSASEEDDKEDSAWEPQKKVPRS. |
|---|
| Other Names | FLJ10379, H_NH0576F01.1, S1 RNA binding domain 1, S1 RNA-binding domain-containing protein 1, WUGSC:H_NH0576F01.1 |
|---|
| Gene, Accession # | SRBD1, Gene ID: 55133, Accession: Q8N5C6, SwissProt: Q8N5C6 |
|---|
| Catalog # | NBP1-57557 |
|---|
| Price | |
|---|
| Order / More Info | SRBD1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|