| Edit |   |
| Antigenic Specificity | rho GTPase Activating Protein 36 (ARHGAP36) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | RP13-102H20.1 is the GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state. |
| Immunogen | RP13-102 H20.1 antibody was raised using the N terminal of RP13-102 20.1 corresponding to a region with amino acids VARHFLSEFKPDRALPIDRPNTLDKWFLILRGQQRAVSHKTFGISLEEVL |
| Other Names | 1100001E04Rik|rho-gap |
| Gene, Accession # | Gene ID: 158763 |
| Catalog # | ABIN636091 |
| Price | |
| Order / More Info | rho GTPase Activating Protein 36 (ARHGAP36) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |