| Edit |   |
|---|
| Antigenic Specificity | rho GTPase Activating Protein 30 (ARHGAP30) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | ARHGAP30 is a GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state. |
|---|
| Immunogen | ARHGAP30 antibody was raised using the N terminal of ARHGAP30 corresponding to a region with amino acids RKWRSIFNLGRSGHETKRKLPRGAEDREDKSNKGTLRPAKSMDSLSAAAG |
|---|
| Other Names | 6030405P05Rik|Gm102|mFLJ00267 |
|---|
| Gene, Accession # | Gene ID: 257106 |
|---|
| Catalog # | ABIN632572 |
|---|
| Price | |
|---|
| Order / More Info | rho GTPase Activating Protein 30 (ARHGAP30) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|