| Edit |   |
|---|
| Antigenic Specificity | rho GTPase Activating Protein 25 (ARHGAP25) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | ARHGAPs, such as ARHGAP25, encode negative regulators of Rho GTPases, which are implicated in actin remodeling, cell polarity, and cell migration. |
|---|
| Immunogen | ARHGAP25 antibody was raised using the middle region of ARHGAP25 corresponding to a region with amino acids SPGEEASALSSQACDSKGDTLASPNSETGPGKKNSGEEEIDSLQRMVQEL |
|---|
| Other Names | arhgap24|DKFZp468H165|KAIA0053|A130039I20Rik|RGD1562105 |
|---|
| Gene, Accession # | Gene ID: 9938 |
|---|
| Catalog # | ABIN631594 |
|---|
| Price | |
|---|
| Order / More Info | rho GTPase Activating Protein 25 (ARHGAP25) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|