| 产品详情 |
| Edit |   |
| Antigenic Specificity | MEKK1 |
| Clone | 2F6 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG2a kappa |
| Format | PE-Atto594 conjugate |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Flow Cytometry. Optimal dilution of this antibody should be experimentally determined. For optimal results using our Tandem dyes, please avoid prolonged exposure to light or extreme temperature fluctuations. These can lead to irreversible degradation or decoupling. When staining intracellular targets, specific attention to the fixation and permeabilization steps in your flow protocol may be required. Please contact our technical support team at technical@novusbio.com if you have any questions. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MEKK1 Antibody (2F6) [PE/Atto594] from Novus Biologicals is a mouse monoclonal antibody to MEKK1. This antibody reacts with human. The MEKK1 Antibody (2F6) [PE/Atto594] has been validated for the following applications: Flow Cytometry. Specificity: Mitogen-activated protein (MAP) kinase cascades are activated by various extracellular stimuli, including growth factors |
| Immunogen | Partial recombinant MAP3K1 (aa1211-1310) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK) |
| Other Names | MAPK/ERK kinase kinase 1, MAPKKK1MAP/ERK kinase kinase 1, MEK kinase 1, MEKK1EC 2.7.11.25, MEKKMEKK 1, mitogen-activated protein kinase kinase kinase 1 |
| Gene, Accession # | MAP3K1, Gene ID: 4214 |
| Catalog # | NBP2-47810PEATT594 |
| Price | |
| Order / More Info | MEKK1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|