| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FKBP14 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FKBP14 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FKBP14. This antibody reacts with human. The FKBP14 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human FKBP14 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHHDALVE |
|---|
| Other Names | 22 kDa FK506-binding protein, EC 5.2.1.8, FK506 binding protein 14 (22 kDa), FK506 binding protein 14, 22 kDa, FK506-binding protein 14, FKBP-14, FKBP-22, FKBP22PPIase FKBP14, FLJ20731, peptidyl-prolyl cis-trans isomerase FKBP14,22 kDa FKBP, rotamase |
|---|
| Gene, Accession # | FKBP14, Gene ID: 55033 |
|---|
| Catalog # | NBP1-83890 |
|---|
| Price | |
|---|
| Order / More Info | FKBP14 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|