| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FKBP12.6 |
|---|
| Clone | 4H5-1B6 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FKBP12.6 Antibody (4H5-1B6) from Novus Biologicals is a mouse monoclonal antibody to FKBP12.6. This antibody reacts with human. The FKBP12.6 Antibody (4H5-1B6) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | FKBP1B (AAH02614, 1 a.a. - 80 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQLGPLSPLPICPHPC |
|---|
| Other Names | 12.6 kDa FK506-binding protein, calstabin 2,12.6 kDa FKBP, EC 5.2.1.8, FK506 binding protein 1B, 12.6 kDa, FK506-binding protein 12.6, FK506-binding protein 1B, FK506-binding protein 1B (12.6 kD), FKBP-12.6, FKBP12.6h-FKBP-12, FKBP-1B, FKBP1L, FKBP9, Immunophilin FKBP12.6, OTK4PPIase FKBP1B, peptidyl-prolyl cis-trans isomerase FKBP1B, PKBP1L, PPIase, Rotamase |
|---|
| Gene, Accession # | FKBP1B, Gene ID: 2281, Accession: AAH02614, SwissProt: AAH02614 |
|---|
| Catalog # | H00002281-M01 |
|---|
| Price | |
|---|
| Order / More Info | FKBP12.6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|