| 产品详情 |
| Edit |   |
| Antigenic Specificity | Osteopontin/OPN |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100 |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Osteopontin/OPN Antibody from Novus Biologicals is a rabbit polyclonal antibody to Osteopontin/OPN. This antibody reacts with human. The Osteopontin/OPN Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Osteopontin/OPN antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SQDSIDSNDSDDVDDTDDSHQSDESHHSDESDELVTDFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQYPDAT |
| Other Names | BNSP, Bone sialoprotein 1, MGC110940, Nephropontin, osteopontin, secreted phosphoprotein 1bone sialoprotein I, early T-lymphocyteactivation 1), secreted phosphoprotein-1 (osteopontin, bone sialoprotein), SPP-1, SPP1/CALPHA1 fusion, Urinary stone protein, uropontin |
| Gene, Accession # | SPP1, Gene ID: 6696 |
| Catalog # | NBP1-89952 |
| Price | |
| Order / More Info | Osteopontin/OPN Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 23435261 |
| 产品资料 |
|
|