| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GCLM |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GCLM Antibody from Novus Biologicals is a rabbit polyclonal antibody to GCLM. This antibody reacts with human, mouse, rat. The GCLM Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat GCLM antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RTLHLQTGNLLNWGRLRKKCPSTHSEELHDCIQKTLNEWSSQINPDLVREFPDVLECTVSHAVE |
|---|
| Other Names | Gamma-ECS regulatory subunit, Gamma-glutamylcysteine synthetase regulatory subunit, GCS light chain, GLCLRglutamate--cysteine ligase regulatory subunit, glutamate-cysteine ligase (gamma-glutamylcysteine synthetase), regulatory(30.8kD), Glutamate--cysteine ligase modifier subunit, glutamate-cysteine ligase regulatory protein, glutamate-cysteine ligase, modifier subunit, GSC light chain |
|---|
| Gene, Accession # | GCLM, Gene ID: 2730 |
|---|
| Catalog # | NBP1-83361 |
|---|
| Price | |
|---|
| Order / More Info | GCLM Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|