| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Defensin alpha 5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Defensin alpha 5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Defensin alpha 5. This antibody reacts with human. The Defensin alpha 5 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Defensin alpha 5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ESLQERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQARATCYCRTGRCATRESLSGVCEISGRLYRLCCR |
|---|
| Other Names | DEF5defensin, alpha 5, preproprotein, defensin 5, Defensin, alpha 5, defensin, alpha 5, Paneth cell-specific, defensin-5, HD-5, MGC129728 |
|---|
| Gene, Accession # | DEFA5, Gene ID: 1670 |
|---|
| Catalog # | NBP1-84282 |
|---|
| Price | |
|---|
| Order / More Info | Defensin alpha 5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 20398667 |
|---|
| 产品资料 |
|
|