| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PSP/BPIFA2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PSP/BPIFA2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PSP/BPIFA2. This antibody reacts with human. The PSP/BPIFA2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PSP/BPIFA2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQII |
|---|
| Other Names | bA49G10.1, chromosome 20 open reading frame 70, Parotid secretory protein, PSP, short palate, lung and nasal epithelium carcinoma associated 2, short palate, lung and nasal epithelium carcinoma-associated protein 2, SPLUNC2 |
|---|
| Gene, Accession # | BPIFA2, Gene ID: 140683 |
|---|
| Catalog # | NBP1-91704 |
|---|
| Price | |
|---|
| Order / More Info | PSP/BPIFA2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|