| 产品详情 |
| Edit |   |
| Antigenic Specificity | PSMG1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PSMG1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PSMG1. This antibody reacts with human. The PSMG1 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human PSMG1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: THLSSTEAFCVFYHLKSNPSVFLCQCSCYVAEDQQYQWLEKVFGSCPRKNMQITILTCRHVTDYKTSESTGSLPSPF |
| Other Names | C21-LRP, C21LRPc21-LRP, Chromosome 21 leucine-rich protein, Down syndrome critical region gene 2, DSCR2leucine rich protein C21-LRP, LRPC21, PAC-1, PAC1Down syndrome critical region protein 2, proteasome (prosome, macropain) assembly chaperone 1, proteasome assembling chaperone 1, proteasome assembly chaperone 1 |
| Gene, Accession # | PSMG1, Gene ID: 8624 |
| Catalog # | NBP2-55971 |
| Price | |
| Order / More Info | PSMG1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|