| Edit |   |
|---|
| Antigenic Specificity | KCTD9 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KCTD9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KCTD9. This antibody reacts with human. The KCTD9 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to KCTD9 (potassium channel tetramerisation domain containing 9) The peptide sequence was selected from the middle region of KCTD9. Peptide sequence AHANLCCANLERADLSGSVLDCANLQGVKMLCSNAEGASLKLCNFEDPSG. |
|---|
| Other Names | BTB/POZ domain-containing protein KCTD9, FLJ20038, potassium channel tetramerisation domain containing 9 |
|---|
| Gene, Accession # | KCTD9, Gene ID: 54793, Accession: Q7L273, SwissProt: Q7L273 |
|---|
| Catalog # | NBP1-57662 |
|---|
| Price | |
|---|
| Order / More Info | KCTD9 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|