| Edit |   |
| Antigenic Specificity | KCTD7 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The KCTD7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KCTD7. This antibody reacts with human. The KCTD7 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human KCTD7 containing the following sequence: VVVTGREPDSRRQDGAMSSSDAEDDFLEPATPTATQAGHALPLLPQEFPE. Peptide sequence VVVTGREPDSRRQDGAMSSSDAEDDFLEPATPTATQAGHALPLLPQEFPE. |
| Other Names | BTB/POZ domain-containing protein KCTD7, EPM3FLJ32069, FLJ45891, potassium channel tetramerisation domain containing 7 |
| Gene, Accession # | KCTD7, Gene ID: 154881, Accession: NP_694578, SwissProt: NP_694578 |
| Catalog # | NBP1-80094 |
| Price | |
| Order / More Info | KCTD7 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |