| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Ataxin-2-like protein |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Ataxin-2-like protein Antibody from Novus Biologicals is a rabbit polyclonal antibody to Ataxin-2-like protein. This antibody reacts with human. The Ataxin-2-like protein Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. Specificity of human Ataxin-2-like protein antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: APISASCPEPPIGSAVPTSSASIPVTSSVSDPGVGSISPASPKISLAPTDVKELSTKEPGRTLEPQELARIAGKVPGLQNEQKRFQLEELRK |
|---|
| Other Names | A2DA2RP, A2LG, A2lp, ataxin 2 related protein, ataxin 2-like, Ataxin-2 domain protein, ataxin-2-like protein, Ataxin-2-related protein |
|---|
| Gene, Accession # | ATXN2L, Gene ID: 11273 |
|---|
| Catalog # | NBP2-48741 |
|---|
| Price | |
|---|
| Order / More Info | Ataxin-2-like protein Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|