| 产品详情 |
| Edit |   |
| Antigenic Specificity | KCTD11 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The KCTD11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KCTD11. This antibody reacts with human. The KCTD11 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human KCTD11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DALRELEASQGTPAPTAALLHADVDVSPRLVHFSARRGPHHYELSSVQVDTFRANLFCTDSECLGALRARFGVAS |
| Other Names | BTB/POZ domain-containing protein KCTD11, C17orf36, chromosome 17 open reading frame 36, MGC129844, potassium channel tetramerisation domain containing 11, REn, REN/KCTD11, RENpotassium channel tetramerization domain containing 11, retinoic acid, EGF, NGF induced gene protein, retinoic acid, EGF, NGF induced gene/potassium channel tetramerization domaincontaining 11 |
| Gene, Accession # | KCTD11, Gene ID: 147040 |
| Catalog # | NBP2-47412 |
| Price | |
| Order / More Info | KCTD11 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|