| Edit |   |
| Antigenic Specificity | KCP |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The KCP Antibody from Novus Biologicals is a rabbit polyclonal antibody to KCP. This antibody reacts with human. The KCP Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The immunogen for this antibody is KCP - N-terminal region. Peptide sequence AHSSVLAGNSQEQWHPLREWLGRLEAAVMELREQNKDLQTRVRQLESCEC. |
| Other Names | CRIM2, KCP1, kielin/chordin-like protein, NET67 |
| Gene, Accession # | KCP, Gene ID: 375616, Accession: NP_955381, SwissProt: NP_955381 |
| Catalog # | NBP1-98275 |
| Price | |
| Order / More Info | KCP Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |