| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | KCNT2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KCNT2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KCNT2. This antibody reacts with human. The KCNT2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human KCNT2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GIYRTESQKLTTSESQISISVEEWEDTKDSKEQGHHRSNHRNSTSSDQSD HPLLRR |
|---|
| Other Names | KCa4.2, MGC119610, MGC119611, MGC119612, potassium channel subfamily T member 2, potassium channel, subfamily T, member 2, Sequence like an intermediate conductance potassium channel subunit, SLICKMGC119613, SLO2.1, sodium activated potassium channel, sodium and chloride activated ATP sensitive potassium channel, sodium- and chloride-activated ATP-sensitive potassium channel, Sodium and chloride-activated ATP-sensitive potassium channel Slo2.1, sodium-and chloride-activated ATP-sensitive potassium channel (SLICK) |
|---|
| Gene, Accession # | KCNT2, Gene ID: 343450 |
|---|
| Catalog # | NBP2-14146 |
|---|
| Price | |
|---|
| Order / More Info | KCNT2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|