| 产品详情 |
| Edit |   |
| Antigenic Specificity | ALKBH8 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ALKBH8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ALKBH8. This antibody reacts with human. The ALKBH8 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ALKBH8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: HTLLRHEGIETVSYATQSLVVANGGLGNGVSRNQLLPVLEKCGLVDALLMPPNKPYSFARYRTTEESKRAYVTLNGKEVV |
| Other Names | ABH8MGC10235, AlkB homologue 8, alkB, alkylation repair homolog 8 (E. coli), alkylated DNA repair protein alkB homolog 8, EC 1.14.11.-, EC 2.1.1.-, FLJ38204, Probable alpha-ketoglutarate-dependent dioxygenase ABH8, S-adenosyl-L-methionine-dependent tRNA methyltransferase ABH8 |
| Gene, Accession # | ALKBH8, Gene ID: 91801, Accession: Q96BT7, SwissProt: Q96BT7 |
| Catalog # | NBP2-38928 |
| Price | |
| Order / More Info | ALKBH8 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|