| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ALKBH7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ALKBH7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ALKBH7. This antibody reacts with human. The ALKBH7 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ALKBH7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SGPSVLSRLQDAAVVRPGFLSTAEEETLSRELEPELRRRRYEYDHWDAAIHGFRETEKSRWSEASRAILQRV |
|---|
| Other Names | ABH7SPATA11, alkB, alkylation repair homolog 7 (E. coli), Alkylated DNA repair protein alkB homolog 7, EC 1.14.11.-, MGC10974, probable alpha-ketoglutarate-dependent dioxygenase ABH7, spermatogenesis associated 11, spermatogenesis cell proliferation related protein, Spermatogenesis cell proliferation-related protein, Spermatogenesis-associated protein 11, UNQ6002 |
|---|
| Gene, Accession # | ALKBH7, Gene ID: 84266, Accession: Q9BT30, SwissProt: Q9BT30 |
|---|
| Catalog # | NBP2-38450 |
|---|
| Price | |
|---|
| Order / More Info | ALKBH7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|