| 产品详情 |
| Edit |   |
| Antigenic Specificity | ALKBH6 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ALKBH6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ALKBH6. This antibody reacts with human. The ALKBH6 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human ALKBH6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NWGGLPHPRGMVPERLPPWLQRYVDKVSNLSLFGGLPANHVLVNQYLPGEGIMPHEDGPLYYPTVSTISLGSHTVLDFYEPRRPEDDDPTEQ |
| Other Names | ABH6, AlkB Homolog 6, AlkB, Alkylation Repair Homolog 6, AlkB, Alkylation Repair Homolog 6 (E. Coli), Alkylated DNA Repair Protein AlkB Homolog 6, Alkylation Repair Homolog 6, Alpha-Ketoglutarate-Dependent Dioxygenase AlkB Homolog 6, EC 1.14.11, Probable Alpha-Ketoglutarate-Dependent Dioxygenase ABH6 |
| Gene, Accession # | ALKBH6, Gene ID: 84964 |
| Catalog # | NBP2-57580 |
| Price | |
| Order / More Info | ALKBH6 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|