| Edit |   |
| Antigenic Specificity | ALKBH4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. For IF, Fixation/Permeabilization: PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ALKBH4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ALKBH4. This antibody reacts with human. The ALKBH4 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ALKBH4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TYRFIYCSDTGWAVGTEESDFEGWAFPFPGVMLIEDFVTREEEAELVRLM DRDPWKLSQSGRRKQDYGPKVN |
| Other Names | ABH4, ALKBH4 alkB, alkylation repair homolog 4 (E. coli) |
| Gene, Accession # | ALKBH4, Gene ID: 54784, Accession: Q9NXW9, SwissProt: Q9NXW9 |
| Catalog # | NBP2-14737 |
| Price | |
| Order / More Info | ALKBH4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |