| 产品详情 |
| Edit |   |
| Antigenic Specificity | ALKBH3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ALKBH3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ALKBH3. This antibody reacts with human. The ALKBH3 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human ALKBH3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NPHWHPVLRTLKNRIEENTGHTFNSLLCNLYRNEKDSVDWHSDDEPSLGRCPIIASLSFGATRTFEMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEY |
| Other Names | ABH3MGC118793, alkB, alkylation repair homolog 3 (E. coli), Alkylated DNA repair protein alkB homolog 3, DEPC1alpha-ketoglutarate-dependent dioxygenase alkB homolog 3, DEPC-1MGC118792, EC 1.14.11, EC 1.14.11.-, FLJ43614, MGC118790, PCA1, Prostate cancer antigen 1, prostate cancer antigen-1 |
| Gene, Accession # | ALKBH3, Gene ID: 221120 |
| Catalog # | NBP2-55419 |
| Price | |
| Order / More Info | ALKBH3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|