| 产品详情 |
| Edit |   |
| Antigenic Specificity | CRISPLD1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CRISPLD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CRISPLD1. This antibody reacts with human. The CRISPLD1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CRISPLD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ACPPSFGGGCRENLCYKEGSDRYYPPREEETNEIERQQSQVHDTHVRTRSDDSSRNEVISAQQMSQIVSCEVRLRDQCKGTTCNRYECPAGC |
| Other Names | CocoaCrisp, CRISP10, CRISP-10, Cysteine-rich secretory protein 10, cysteine-rich secretory protein LCCL domain containing 1, cysteine-rich secretory protein LCCL domain-containing 1, DKFZp762F133, LCCL domain containing cysteine-rich secretory protein 1, LCCL domain-containing cysteine-rich secretory protein 1, LCRISP1, Trypsin inhibitor Hl |
| Gene, Accession # | CRISPLD1, Gene ID: 83690 |
| Catalog # | NBP1-84413 |
| Price | |
| Order / More Info | CRISPLD1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|