| Edit |   |
|---|
| Antigenic Specificity | Claudin 8 (CLDN8) (C-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | CLDN8, clustered with CLDN17 at human chromosome 21q22.11, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C. |
|---|
| Immunogen | Claudin 8 antibody was raised using the C terminal of CLDN8 corresponding to a region with amino acids IVGGALFCCVFCCNEKSSSYRYSIPSHRTTQKSYHTGKKSPSVYSRSQYV |
|---|
| Other Names | zgc:91900|wu:fa01e05|CLDN8|AI648025 |
|---|
| Gene, Accession # | Gene ID: 9073 |
|---|
| Catalog # | ABIN630268 |
|---|
| Price | |
|---|
| Order / More Info | Claudin 8 (CLDN8) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|