| Edit |   |
|---|
| Antigenic Specificity | Claudin 23 (CLDN23) (C-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | CLDN23 is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C. It is a candidate tumor suppressor gene implicated in intestinal-type gastric cancer. |
|---|
| Immunogen | Claudin 23 antibody was raised using the C terminal of CLDN23 corresponding to a region with amino acids IKYYSDGQHRPPPAQHRKPKPKPKVGFPMPRPRPKAYTNSVDVLDGEGWE |
|---|
| Other Names | CLDN23|CLDNL|hCG1646163|2310014B08Rik |
|---|
| Gene, Accession # | Gene ID: 137075 |
|---|
| Catalog # | ABIN634675 |
|---|
| Price | |
|---|
| Order / More Info | Claudin 23 (CLDN23) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|