| Edit |   |
| Antigenic Specificity | Ubiquitin |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Ubiquitin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Ubiquitin. This antibody reacts with human. The Ubiquitin Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human Ubiquitin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPED |
| Other Names | RPS27A, UBA52, UBB ubiquitin B, UBC |
| Gene, Accession # | RPS27A, Gene ID: 6233 |
| Catalog # | NBP2-58398 |
| Price | |
| Order / More Info | Ubiquitin Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |