| Edit |   |
|---|
| Antigenic Specificity | HMGCL |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HMGCL Antibody from Novus Biologicals is a rabbit polyclonal antibody to HMGCL. This antibody reacts with human. The HMGCL Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to HMGCL(3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase (hydroxymethylglutaricaciduria)) The peptide sequence was selected from the N terminal of HMGCL (NP_000182). Peptide sequence WVPQMGDHTEVLKGIQKFPGINYPVLTPNLKGF |
|---|
| Other Names | 3-hydroxy-3-methylglutaryl-CoA lyase, 3-hydroxymethyl-3-methylglutaryl-CoA lyase, EC 4.1.3.4, HLmitochondrial |
|---|
| Gene, Accession # | HMGCL, Gene ID: 3155, Accession: P35914, SwissProt: P35914 |
|---|
| Catalog # | NBP1-58026 |
|---|
| Price | |
|---|
| Order / More Info | HMGCL Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25686106, 30664838 |
|---|