| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Pax5/BSAP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. IHC reported by a verified customer review. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Pax5/BSAP Antibody from Novus Biologicals is a rabbit polyclonal antibody to Pax5/BSAP. This antibody reacts with human. The Pax5/BSAP Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Pax5/BSAP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQL |
|---|
| Other Names | B cell specific activator protein, B-cell-specific transcription factor, BSAPB-cell lineage specific activator, paired box 5, paired box gene 5 (B-cell lineage specific activator protein), paired box gene 5 (B-cell lineage specific activator), paired box homeotic gene 5, paired box protein Pax-5, transcription factor PAX 5 |
|---|
| Gene, Accession # | PAX5, Gene ID: 5079, Accession: Q02548, SwissProt: Q02548 |
|---|
| Catalog # | NBP2-38790 |
|---|
| Price | |
|---|
| Order / More Info | Pax5/BSAP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|