| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TGIF1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TGIF1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TGIF1. This antibody reacts with human. The TGIF1 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human TGIF1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SVLARPSVICHTTVTALKDVPFSLCQSVGVGQNTDIQQIAAKNFTDTSLMYPEDTCKSGPSTNTQ |
|---|
| Other Names | 5'-TG-3' interacting factor, homeobox protein TGIF, homeobox protein TGIF1, HPE4, MGC39747, TALE homeobox TG-interacting factor, TGFB-induced factor (TALE family homeobox), TGFB-induced factor homeobox 1, TGIFMGC5066,5'-TG-3'-interacting factor 1, transforming growth factor-beta-induced factor |
|---|
| Gene, Accession # | TGIF1, Gene ID: 7050 |
|---|
| Catalog # | NBP2-55829 |
|---|
| Price | |
|---|
| Order / More Info | TGIF1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|