| Edit |   |
|---|
| Antigenic Specificity | RPL37A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RPL37A Antibody from Novus Biologicals is a rabbit polyclonal antibody to RPL37A. This antibody reacts with human. The RPL37A Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to RPL37A(ribosomal protein L37a) The peptide sequence was selected from the middle region of RPL37A. Peptide sequence CGKTKMKRRAVGIWHCGSCMKTVAGGAWTYNTTSAVTVKSAIRRLKELKD. |
|---|
| Other Names | 60S ribosomal protein L37a, MGC74786, ribosomal protein L37a |
|---|
| Gene, Accession # | RPL37A, Gene ID: 6168, Accession: P61513, SwissProt: P61513 |
|---|
| Catalog # | NBP1-55204 |
|---|
| Price | |
|---|
| Order / More Info | RPL37A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|