| Edit |   |
| Antigenic Specificity | RPL37A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RPL37A Antibody from Novus Biologicals is a rabbit polyclonal antibody to RPL37A. This antibody reacts with human. The RPL37A Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to RPL37A(ribosomal protein L37a) The peptide sequence was selected from the middle region of RPL37A. Peptide sequence CGKTKMKRRAVGIWHCGSCMKTVAGGAWTYNTTSAVTVKSAIRRLKELKD. |
| Other Names | 60S ribosomal protein L37a, MGC74786, ribosomal protein L37a |
| Gene, Accession # | RPL37A, Gene ID: 6168, Accession: P61513, SwissProt: P61513 |
| Catalog # | NBP1-55204-20ul |
| Price | |
| Order / More Info | RPL37A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |