| Edit |   |
| Antigenic Specificity | RPL37A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RPL37A Antibody from Novus Biologicals is a rabbit polyclonal antibody to RPL37A. This antibody reacts with human. The RPL37A Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human RPL37A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KMKRRAVGIWHCGSCVKTVAGGAWTYNTTSAVTVKSAIRRLKELKDQ |
| Other Names | 60S ribosomal protein L37a, MGC74786, ribosomal protein L37a |
| Gene, Accession # | RPL37A, Gene ID: 6168 |
| Catalog # | NBP2-49441 |
| Price | |
| Order / More Info | RPL37A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |