| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RPL36A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RPL36A Antibody from Novus Biologicals is a rabbit polyclonal antibody to RPL36A. This antibody reacts with human. The RPL36A Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human RPL36A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQG |
|---|
| Other Names | 60S ribosomal protein L36a, Cell growth-inhibiting gene 15 protein, Cell migration-inducing gene 6 protein, dJ164F3.3 (ribosomal protein L44), L44L, L44-like ribosomal protein, MGC72020, MIG6,60S ribosomal protein L44, ribosomal protein L36a, ribosomal protein L44, RPL36AL, RPL44 |
|---|
| Gene, Accession # | RPL36A, Gene ID: 6173 |
|---|
| Catalog # | NBP2-57883 |
|---|
| Price | |
|---|
| Order / More Info | RPL36A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|