| Edit |   |
|---|
| Antigenic Specificity | RPL18A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RPL18A Antibody from Novus Biologicals is a rabbit polyclonal antibody to RPL18A. This antibody reacts with human. The RPL18A Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human RPL18A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RAHSIQIMKVEEIAASKCRRPAVKQFHDSKIKFPLPHRVLRRQHKPRFTTKRPNTFF |
|---|
| Other Names | 60S ribosomal protein L18a, ribosomal protein L18a, ribosomal protein L18a-like protein |
|---|
| Gene, Accession # | RPL18A, Gene ID: 6142, Accession: Q02543, SwissProt: Q02543 |
|---|
| Catalog # | NBP2-30708 |
|---|
| Price | |
|---|
| Order / More Info | RPL18A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25785838 |
|---|