| Edit |   |
|---|
| Antigenic Specificity | RPL13A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RPL13A Antibody from Novus Biologicals is a rabbit polyclonal antibody to RPL13A. This antibody reacts with human. The RPL13A Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to RPL13A(ribosomal protein L13a) The peptide sequence was selected from the middle region of RPL13A. Peptide sequence HEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVEKKIDKY. |
|---|
| Other Names | 60S ribosomal protein L13a, ribosomal protein L13a, tissue specific transplantation antigen 1,23 kDa highly basic protein, TSTA1 |
|---|
| Gene, Accession # | RPL13A, Gene ID: 23521, Accession: P40429, SwissProt: P40429 |
|---|
| Catalog # | NBP1-55222 |
|---|
| Price | |
|---|
| Order / More Info | RPL13A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|