| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TGFBR3L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TGFBR3L Antibody from Novus Biologicals is a rabbit polyclonal antibody to TGFBR3L. This antibody reacts with human. The TGFBR3L Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human TGFBR3L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FPGGLKGSARFLSFGPPFPAPPAPPFPAAPGPWLRRPLFSLKLSDTEDVFP |
|---|
| Other Names | TGF-Beta Receptor Type III-Like Protein, TGF-Beta Receptor Type-3-Like Protein, TGFR-3L, Transforming Growth Factor Beta Receptor 3 Like, Transforming Growth Factor, Beta Receptor III-Like, Transforming Growth Factor-Beta Receptor Type 3-Like Protein, Transforming Growth Factor-Beta Receptor Type III-Like Protein |
|---|
| Gene, Accession # | TGFBR3L, Gene ID: 100507588 |
|---|
| Catalog # | NBP2-57581 |
|---|
| Price | |
|---|
| Order / More Info | TGFBR3L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|