| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Glycophorin A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Glycophorin A Antibody from Novus Biologicals is a rabbit polyclonal antibody to Glycophorin A. This antibody reacts with human. The Glycophorin A Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Glycophorin A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEP |
|---|
| Other Names | CD235a antigen, glycophorin A (includes MN blood group), glycophorin A (MNS blood group), glycophorin Erik, glycophorin MiI, glycophorin MiIII, glycophorin MiV, glycophorin MiX, glycophorin SAT, glycophorin Sta type C, glycophorin-A, GPA, GPErik, GpMiIII, GPSAT, HGpMiIII, HGpMiV, HGpMiX, HGpMiXI, HGpSta(C), Mi.V glycoprotein (24 AA), MN sialoglycoprotein, MNS, PAS-2, recombinant glycophorin A-B Miltenberger-DR |
|---|
| Gene, Accession # | GYPA, Gene ID: 2993 |
|---|
| Catalog # | NBP1-85775 |
|---|
| Price | |
|---|
| Order / More Info | Glycophorin A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|